ATP6V1F polyclonal antibody (A01)
  • ATP6V1F polyclonal antibody (A01)

ATP6V1F polyclonal antibody (A01)

Ref: AB-H00009296-A01
ATP6V1F polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ATP6V1F.
Información adicional
Size 50 uL
Gene Name ATP6V1F
Gene Alias ATP6S14|MGC117321|MGC126037|MGC126038|VATF|Vma7
Gene Description ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATP6V1F (NP_004222, 10 a.a. ~ 119 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9296

Enviar un mensaje


ATP6V1F polyclonal antibody (A01)

ATP6V1F polyclonal antibody (A01)