NPIP polyclonal antibody (A01)
  • NPIP polyclonal antibody (A01)

NPIP polyclonal antibody (A01)

Ref: AB-H00009284-A01
NPIP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NPIP.
Información adicional
Size 50 uL
Gene Name NPIP
Gene Alias FLJ42525|FLJ44848
Gene Description nuclear pore complex interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EGIKIVLEDIFTLWRQVETKVRAKIRKMKVTTKVNRHDKINGKRKTAKEHLRKLSMKEREHGEKERQVSEAEENGKLDMKEIHTYMEMFQRAQALRRRAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NPIP (NP_008916, 97 a.a. ~ 196 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9284

Enviar un mensaje


NPIP polyclonal antibody (A01)

NPIP polyclonal antibody (A01)