BCL7B purified MaxPab rabbit polyclonal antibody (D01P)
  • BCL7B purified MaxPab rabbit polyclonal antibody (D01P)

BCL7B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009275-D01P
BCL7B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BCL7B protein.
Información adicional
Size 100 ug
Gene Name BCL7B
Gene Alias -
Gene Description B-cell CLL/lymphoma 7B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BCL7B (NP_001698.2, 1 a.a. ~ 202 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9275

Enviar un mensaje


BCL7B purified MaxPab rabbit polyclonal antibody (D01P)

BCL7B purified MaxPab rabbit polyclonal antibody (D01P)