BCL7B polyclonal antibody (A01)
  • BCL7B polyclonal antibody (A01)

BCL7B polyclonal antibody (A01)

Ref: AB-H00009275-A01
BCL7B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BCL7B.
Información adicional
Size 50 uL
Gene Name BCL7B
Gene Alias -
Gene Description B-cell CLL/lymphoma 7B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BCL7B (NP_001698, 124 a.a. ~ 202 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9275

Enviar un mensaje


BCL7B polyclonal antibody (A01)

BCL7B polyclonal antibody (A01)