ITGB1BP1 monoclonal antibody (M04), clone 3G4
  • ITGB1BP1 monoclonal antibody (M04), clone 3G4

ITGB1BP1 monoclonal antibody (M04), clone 3G4

Ref: AB-H00009270-M04
ITGB1BP1 monoclonal antibody (M04), clone 3G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITGB1BP1.
Información adicional
Size 100 ug
Gene Name ITGB1BP1
Gene Alias DKFZp686K08158|ICAP-1A|ICAP-1B|ICAP-1alpha|ICAP1|ICAP1A|ICAP1B
Gene Description integrin beta 1 binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGB1BP1 (AAH12264, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9270
Clone Number 3G4
Iso type IgG2b Kappa

Enviar un mensaje


ITGB1BP1 monoclonal antibody (M04), clone 3G4

ITGB1BP1 monoclonal antibody (M04), clone 3G4