ITGB1BP1 polyclonal antibody (A01)
  • ITGB1BP1 polyclonal antibody (A01)

ITGB1BP1 polyclonal antibody (A01)

Ref: AB-H00009270-A01
ITGB1BP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITGB1BP1.
Información adicional
Size 50 uL
Gene Name ITGB1BP1
Gene Alias DKFZp686K08158|ICAP-1A|ICAP-1B|ICAP-1alpha|ICAP1|ICAP1A|ICAP1B
Gene Description integrin beta 1 binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGB1BP1 (AAH12264, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9270

Enviar un mensaje


ITGB1BP1 polyclonal antibody (A01)

ITGB1BP1 polyclonal antibody (A01)