PSCD1 purified MaxPab rabbit polyclonal antibody (D01P)
  • PSCD1 purified MaxPab rabbit polyclonal antibody (D01P)

PSCD1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009267-D01P
PSCD1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PSCD1 protein.
Información adicional
Size 100 ug
Gene Name CYTH1
Gene Alias B2-1|CYTOHESIN-1|D17S811E|FLJ34050|FLJ41900|PSCD1|SEC7
Gene Description cytohesin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PSCD1 (NP_004753.1, 1 a.a. ~ 398 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9267

Enviar un mensaje


PSCD1 purified MaxPab rabbit polyclonal antibody (D01P)

PSCD1 purified MaxPab rabbit polyclonal antibody (D01P)