CYTH2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CYTH2 purified MaxPab rabbit polyclonal antibody (D01P)

CYTH2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009266-D01P
CYTH2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CYTH2 protein.
Información adicional
Size 100 ug
Gene Name CYTH2
Gene Alias ARNO|CTS18|CTS18.1|PSCD2|PSCD2L|SEC7L|Sec7p-L|Sec7p-like
Gene Description cytohesin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYTH2 (NP_059431.1, 1 a.a. ~ 400 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9266

Enviar un mensaje


CYTH2 purified MaxPab rabbit polyclonal antibody (D01P)

CYTH2 purified MaxPab rabbit polyclonal antibody (D01P)