STK17A monoclonal antibody (M02), clone 3G8
  • STK17A monoclonal antibody (M02), clone 3G8

STK17A monoclonal antibody (M02), clone 3G8

Ref: AB-H00009263-M02
STK17A monoclonal antibody (M02), clone 3G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STK17A.
Información adicional
Size 100 ug
Gene Name STK17A
Gene Alias DRAK1
Gene Description serine/threonine kinase 17a
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETEESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGEFI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STK17A (AAH47696, 301 a.a. ~ 413 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9263
Clone Number 3G8
Iso type IgG2a Kappa

Enviar un mensaje


STK17A monoclonal antibody (M02), clone 3G8

STK17A monoclonal antibody (M02), clone 3G8