STK17A MaxPab rabbit polyclonal antibody (D01)
  • STK17A MaxPab rabbit polyclonal antibody (D01)

STK17A MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009263-D01
STK17A MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human STK17A protein.
Información adicional
Size 100 uL
Gene Name STK17A
Gene Alias DRAK1
Gene Description serine/threonine kinase 17a
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MIPLEKPGSGGSSPGATSGSGRAGRGLSGPCRPPPPPQARGLLTEIRAVVRTEPFQDGYSLCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDNPWVINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STK17A (AAH47696.1, 1 a.a. ~ 414 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9263

Enviar un mensaje


STK17A MaxPab rabbit polyclonal antibody (D01)

STK17A MaxPab rabbit polyclonal antibody (D01)