CACNA2D2 polyclonal antibody (A01) Ver mas grande

CACNA2D2 polyclonal antibody (A01)

AB-H00009254-A01

Producto nuevo

CACNA2D2 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name CACNA2D2
Gene Alias CACNA2D|KIAA0558|LUAC11.1
Gene Description calcium channel, voltage-dependent, alpha 2/delta subunit 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CACNA2D2 (NP_006021, 65 a.a. ~ 162 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9254

Más información

Mouse polyclonal antibody raised against a partial recombinant CACNA2D2.

Consulta sobre un producto

CACNA2D2 polyclonal antibody (A01)

CACNA2D2 polyclonal antibody (A01)