UBE2L6 monoclonal antibody (M01A), clone S1
  • UBE2L6 monoclonal antibody (M01A), clone S1

UBE2L6 monoclonal antibody (M01A), clone S1

Ref: AB-H00009246-M01A
UBE2L6 monoclonal antibody (M01A), clone S1

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant UBE2L6.
Información adicional
Size 200 uL
Gene Name UBE2L6
Gene Alias MGC40331|RIG-B|UBCH8
Gene Description ubiquitin-conjugating enzyme E2L 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2L6 (AAH32491, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 9246
Clone Number S1
Iso type IgG1 Kappa

Enviar un mensaje


UBE2L6 monoclonal antibody (M01A), clone S1

UBE2L6 monoclonal antibody (M01A), clone S1