UBE2L6 monoclonal antibody (M01), clone 2F12-1F4
  • UBE2L6 monoclonal antibody (M01), clone 2F12-1F4

UBE2L6 monoclonal antibody (M01), clone 2F12-1F4

Ref: AB-H00009246-M01
UBE2L6 monoclonal antibody (M01), clone 2F12-1F4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant UBE2L6.
Información adicional
Size 100 ug
Gene Name UBE2L6
Gene Alias MGC40331|RIG-B|UBCH8
Gene Description ubiquitin-conjugating enzyme E2L 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2L6 (AAH32491, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9246
Clone Number 2F12-1F4
Iso type IgG1 kappa

Enviar un mensaje


UBE2L6 monoclonal antibody (M01), clone 2F12-1F4

UBE2L6 monoclonal antibody (M01), clone 2F12-1F4