UBE2L6 purified MaxPab mouse polyclonal antibody (B01P)
  • UBE2L6 purified MaxPab mouse polyclonal antibody (B01P)

UBE2L6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009246-B01P
UBE2L6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UBE2L6 protein.
Información adicional
Size 50 ug
Gene Name UBE2L6
Gene Alias MGC40331|RIG-B|UBCH8
Gene Description ubiquitin-conjugating enzyme E2L 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBE2L6 (NP_004214.1, 1 a.a. ~ 153 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9246

Enviar un mensaje


UBE2L6 purified MaxPab mouse polyclonal antibody (B01P)

UBE2L6 purified MaxPab mouse polyclonal antibody (B01P)