UBE2L6 polyclonal antibody (A01)
  • UBE2L6 polyclonal antibody (A01)

UBE2L6 polyclonal antibody (A01)

Ref: AB-H00009246-A01
UBE2L6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant UBE2L6.
Información adicional
Size 50 uL
Gene Name UBE2L6
Gene Alias MGC40331|RIG-B|UBCH8
Gene Description ubiquitin-conjugating enzyme E2L 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2L6 (AAH32491, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9246

Enviar un mensaje


UBE2L6 polyclonal antibody (A01)

UBE2L6 polyclonal antibody (A01)