Ver mas grande
MSC monoclonal antibody (M05), clone 4D7
AB-H00009242-M05
Producto nuevo
MSC monoclonal antibody (M05), clone 4D7
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | MSC |
| Gene Alias | ABF-1|ABF1|MYOR|bHLHa22 |
| Gene Description | musculin (activated B-cell factor-1) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCALGTAGSAEGCKRKRPRVAGGGGAGGSAGGGGKKPLPAKGS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MSC (NP_005089.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9242 |
| Clone Number | 4D7 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant MSC.