MSC monoclonal antibody (M05), clone 4D7
  • MSC monoclonal antibody (M05), clone 4D7

MSC monoclonal antibody (M05), clone 4D7

Ref: AB-H00009242-M05
MSC monoclonal antibody (M05), clone 4D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MSC.
Información adicional
Size 100 ug
Gene Name MSC
Gene Alias ABF-1|ABF1|MYOR|bHLHa22
Gene Description musculin (activated B-cell factor-1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCALGTAGSAEGCKRKRPRVAGGGGAGGSAGGGGKKPLPAKGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MSC (NP_005089.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9242
Clone Number 4D7
Iso type IgG2b Kappa

Enviar un mensaje


MSC monoclonal antibody (M05), clone 4D7

MSC monoclonal antibody (M05), clone 4D7