NOG monoclonal antibody (M11), clone 2C10
  • NOG monoclonal antibody (M11), clone 2C10

NOG monoclonal antibody (M11), clone 2C10

Ref: AB-H00009241-M11
NOG monoclonal antibody (M11), clone 2C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NOG.
Información adicional
Size 100 ug
Gene Name NOG
Gene Alias SYM1|SYNS1
Gene Description noggin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq GQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NOG (NP_005441, 27 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9241
Clone Number 2C10
Iso type IgG2b Kappa

Enviar un mensaje


NOG monoclonal antibody (M11), clone 2C10

NOG monoclonal antibody (M11), clone 2C10