NOG MaxPab rabbit polyclonal antibody (D01)
  • NOG MaxPab rabbit polyclonal antibody (D01)

NOG MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009241-D01
NOG MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NOG protein.
Información adicional
Size 100 uL
Gene Name NOG
Gene Alias SYM1|SYNS1
Gene Description noggin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NOG (NP_005441.1, 1 a.a. ~ 232 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9241

Enviar un mensaje


NOG MaxPab rabbit polyclonal antibody (D01)

NOG MaxPab rabbit polyclonal antibody (D01)