IL32 MaxPab rabbit polyclonal antibody (D01)
  • IL32 MaxPab rabbit polyclonal antibody (D01)

IL32 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009235-D01
IL32 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL32 protein.
Información adicional
Size 100 uL
Gene Name IL32
Gene Alias IL-32alpha|IL-32beta|IL-32delta|IL-32gamma|NK4|TAIF|TAIFa|TAIFb|TAIFc|TAIFd
Gene Description interleukin 32
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL32 (NP_001012649.1, 1 a.a. ~ 188 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9235

Enviar un mensaje


IL32 MaxPab rabbit polyclonal antibody (D01)

IL32 MaxPab rabbit polyclonal antibody (D01)