PTTG1 polyclonal antibody (A01)
  • PTTG1 polyclonal antibody (A01)

PTTG1 polyclonal antibody (A01)

Ref: AB-H00009232-A01
PTTG1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PTTG1.
Información adicional
Size 50 uL
Gene Name PTTG1
Gene Alias EAP1|HPTTG|MGC126883|MGC138276|PTTG|TUTR1
Gene Description pituitary tumor-transforming 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKTFDAPPALPKATRKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTTG1 (NP_004210, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9232

Enviar un mensaje


PTTG1 polyclonal antibody (A01)

PTTG1 polyclonal antibody (A01)