DLG5 polyclonal antibody (A01) Ver mas grande

DLG5 polyclonal antibody (A01)

AB-H00009231-A01

Producto nuevo

DLG5 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name DLG5
Gene Alias KIAA0583|LP-DLG|P-DLG5|PDLG
Gene Description discs, large homolog 5 (Drosophila)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPACPL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLG5 (NP_004738, 1708 a.a. ~ 1809 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9231

Más información

Mouse polyclonal antibody raised against a partial recombinant DLG5.

Consulta sobre un producto

DLG5 polyclonal antibody (A01)

DLG5 polyclonal antibody (A01)