DLG5 polyclonal antibody (A01)
  • DLG5 polyclonal antibody (A01)

DLG5 polyclonal antibody (A01)

Ref: AB-H00009231-A01
DLG5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DLG5.
Información adicional
Size 50 uL
Gene Name DLG5
Gene Alias KIAA0583|LP-DLG|P-DLG5|PDLG
Gene Description discs, large homolog 5 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPACPL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLG5 (NP_004738, 1708 a.a. ~ 1809 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9231

Enviar un mensaje


DLG5 polyclonal antibody (A01)

DLG5 polyclonal antibody (A01)