VAPA MaxPab rabbit polyclonal antibody (D01)
  • VAPA MaxPab rabbit polyclonal antibody (D01)

VAPA MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009218-D01
VAPA MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human VAPA protein.
Información adicional
Size 100 uL
Gene Name VAPA
Gene Alias MGC3745|VAP-33|VAP-A|VAP33|hVAP-33
Gene Description VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VAPA (ENSP00000217602, 1 a.a. ~ 242 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9218

Enviar un mensaje


VAPA MaxPab rabbit polyclonal antibody (D01)

VAPA MaxPab rabbit polyclonal antibody (D01)