SLC24A1 monoclonal antibody (M01), clone 1E12
  • SLC24A1 monoclonal antibody (M01), clone 1E12

SLC24A1 monoclonal antibody (M01), clone 1E12

Ref: AB-H00009187-M01
SLC24A1 monoclonal antibody (M01), clone 1E12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC24A1.
Información adicional
Size 100 ug
Gene Name SLC24A1
Gene Alias HsT17412|KIAA0702|NCKX|NCKX1|RODX
Gene Description solute carrier family 24 (sodium/potassium/calcium exchanger), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IVKKYTPTPRGEMKSYSPTQVREKVKYTPSPRGRRVGTYVPSTFMTMETSHAITPRTTVKDSDITATYKILETNSLKRIMEETTPTTLKGMFDSTPTFLTHEVEANV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC24A1 (NP_004718, 162 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9187
Clone Number 1E12
Iso type IgG2a Kappa

Enviar un mensaje


SLC24A1 monoclonal antibody (M01), clone 1E12

SLC24A1 monoclonal antibody (M01), clone 1E12