SLC24A1 polyclonal antibody (A01)
  • SLC24A1 polyclonal antibody (A01)

SLC24A1 polyclonal antibody (A01)

Ref: AB-H00009187-A01
SLC24A1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC24A1.
Información adicional
Size 50 uL
Gene Name SLC24A1
Gene Alias HsT17412|KIAA0702|NCKX|NCKX1|RODX
Gene Description solute carrier family 24 (sodium/potassium/calcium exchanger), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IVKKYTPTPRGEMKSYSPTQVREKVKYTPSPRGRRVGTYVPSTFMTMETSHAITPRTTVKDSDITATYKILETNSLKRIMEETTPTTLKGMFDSTPTFLTHEVEANV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC24A1 (NP_004718, 162 a.a. ~ 268 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9187

Enviar un mensaje


SLC24A1 polyclonal antibody (A01)

SLC24A1 polyclonal antibody (A01)