ZW10 purified MaxPab rabbit polyclonal antibody (D01P)
  • ZW10 purified MaxPab rabbit polyclonal antibody (D01P)

ZW10 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009183-D01P
ZW10 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZW10 protein.
Información adicional
Size 100 ug
Gene Name ZW10
Gene Alias HZW10|KNTC1AP|MGC149821
Gene Description ZW10, kinetochore associated, homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASFVTEVLAHSGRLEKEDLGTRISRLTRRVEEIKGEVCNMISKKYSEFLPSMQSAQGLITQVDKLSEDIDLLKSRIESEVRRDLHVSTGEFTDLKQQLERDSVVLSLLKQLQEFSTAIEEYNCALTEKKYVTGAQRLEEAQKCLKLLKSRKCFDLKILKSLSMELTIQKQNILYHLGEEWQKLIVWKFPPSKDTSSLESYLQTELHLYTEQSHKEEKTPMPPISSVLLAFSVLGELHSKLKSFGQMLLKYILRP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZW10 (NP_004715.1, 1 a.a. ~ 779 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9183

Enviar un mensaje


ZW10 purified MaxPab rabbit polyclonal antibody (D01P)

ZW10 purified MaxPab rabbit polyclonal antibody (D01P)