AP4M1 polyclonal antibody (A01)
  • AP4M1 polyclonal antibody (A01)

AP4M1 polyclonal antibody (A01)

Ref: AB-H00009179-A01
AP4M1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant AP4M1.
Información adicional
Size 50 uL
Gene Name AP4M1
Gene Alias MU-4|MU-ARP2
Gene Description adaptor-related protein complex 4, mu 1 subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AP4M1 (NP_004713, 354 a.a. ~ 453 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9179

Enviar un mensaje


AP4M1 polyclonal antibody (A01)

AP4M1 polyclonal antibody (A01)