HTR3B purified MaxPab mouse polyclonal antibody (B01P)
  • HTR3B purified MaxPab mouse polyclonal antibody (B01P)

HTR3B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009177-B01P
HTR3B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HTR3B protein.
Información adicional
Size 50 ug
Gene Name HTR3B
Gene Alias 5-HT3B
Gene Description 5-hydroxytryptamine (serotonin) receptor 3B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLML
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HTR3B (NP_006019.1, 1 a.a. ~ 441 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9177

Enviar un mensaje


HTR3B purified MaxPab mouse polyclonal antibody (B01P)

HTR3B purified MaxPab mouse polyclonal antibody (B01P)