PCSK7 purified MaxPab mouse polyclonal antibody (B01P)
  • PCSK7 purified MaxPab mouse polyclonal antibody (B01P)

PCSK7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009159-B01P
PCSK7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PCSK7 protein.
Información adicional
Size 50 ug
Gene Name PCSK7
Gene Alias LPC|PC7|PC8|SPC7
Gene Description proprotein convertase subtilisin/kexin type 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPKGRQKVPHLDAPLGLPTCLWLELAGLFLLVPWVMGLAGTGGPDGQGTGGPSWAVHLESLEGDGEEETLEQQADALAQAAGLVNAGRIGELQGHYLFVQPAGHRPALEVEAIRQQVEAVLAGHEAVRWHSEQRLLRRAKRSVHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRGVTVVVVDDGVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVENGNHHGTRCAGEIAAVPNNSFCAVGVAYGSRI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PCSK7 (AAH06357.1, 1 a.a. ~ 591 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9159

Enviar un mensaje


PCSK7 purified MaxPab mouse polyclonal antibody (B01P)

PCSK7 purified MaxPab mouse polyclonal antibody (B01P)