SLC28A2 monoclonal antibody (M03), clone 2D3
  • SLC28A2 monoclonal antibody (M03), clone 2D3

SLC28A2 monoclonal antibody (M03), clone 2D3

Ref: AB-H00009153-M03
SLC28A2 monoclonal antibody (M03), clone 2D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC28A2.
Información adicional
Size 100 ug
Gene Name SLC28A2
Gene Alias CNT2|HCNT2|HsT17153|MGC138252|SPNT1
Gene Description solute carrier family 28 (sodium-coupled nucleoside transporter), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEKASGRQSIALSTVETGTVNLGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHARLFKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC28A2 (NP_004203.1, 1 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9153
Clone Number 2D3
Iso type IgG2a Kappa

Enviar un mensaje


SLC28A2 monoclonal antibody (M03), clone 2D3

SLC28A2 monoclonal antibody (M03), clone 2D3