SLC6A5 monoclonal antibody (M01), clone 3B3
  • SLC6A5 monoclonal antibody (M01), clone 3B3

SLC6A5 monoclonal antibody (M01), clone 3B3

Ref: AB-H00009152-M01
SLC6A5 monoclonal antibody (M01), clone 3B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC6A5.
Información adicional
Size 100 ug
Gene Name SLC6A5
Gene Alias GLYT2|NET1
Gene Description solute carrier family 6 (neurotransmitter transporter, glycine), member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC6A5 (NP_004202, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9152
Clone Number 3B3
Iso type IgG1 Kappa

Enviar un mensaje


SLC6A5 monoclonal antibody (M01), clone 3B3

SLC6A5 monoclonal antibody (M01), clone 3B3