DYRK1B polyclonal antibody (A01)
  • DYRK1B polyclonal antibody (A01)

DYRK1B polyclonal antibody (A01)

Ref: AB-H00009149-A01
DYRK1B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DYRK1B.
Información adicional
Size 50 uL
Gene Name DYRK1B
Gene Alias MIRK
Gene Description dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DYRK1B (AAH25291, 479 a.a. ~ 569 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9149

Enviar un mensaje


DYRK1B polyclonal antibody (A01)

DYRK1B polyclonal antibody (A01)