HGS monoclonal antibody (M01), clone 6D11
  • HGS monoclonal antibody (M01), clone 6D11

HGS monoclonal antibody (M01), clone 6D11

Ref: AB-H00009146-M01
HGS monoclonal antibody (M01), clone 6D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HGS.
Información adicional
Size 100 ug
Gene Name HGS
Gene Alias HRS|ZFYVE8
Gene Description hepatocyte growth factor-regulated tyrosine kinase substrate
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HGS (AAH03565, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9146
Clone Number 6D11
Iso type IgG1 Kappa

Enviar un mensaje


HGS monoclonal antibody (M01), clone 6D11

HGS monoclonal antibody (M01), clone 6D11