SYNGR2 monoclonal antibody (M01), clone 5C3
  • SYNGR2 monoclonal antibody (M01), clone 5C3

SYNGR2 monoclonal antibody (M01), clone 5C3

Ref: AB-H00009144-M01
SYNGR2 monoclonal antibody (M01), clone 5C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SYNGR2.
Información adicional
Size 100 ug
Gene Name SYNGR2
Gene Alias MGC102914
Gene Description synaptogyrin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SYNGR2 (NP_004701, 168 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9144
Clone Number 5C3
Iso type IgG3 Kappa

Enviar un mensaje


SYNGR2 monoclonal antibody (M01), clone 5C3

SYNGR2 monoclonal antibody (M01), clone 5C3