ATG12 purified MaxPab mouse polyclonal antibody (B01P)
  • ATG12 purified MaxPab mouse polyclonal antibody (B01P)

ATG12 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009140-B01P
ATG12 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ATG12 protein.
Información adicional
Size 50 ug
Gene Name ATG12
Gene Alias APG12|APG12L|FBR93|HAPG12
Gene Description ATG12 autophagy related 12 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTSREHQVSLCNCVPLLRRLLCDAPWRKARPLHALSRYFRSRVSPSKMAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ATG12 (NP_004698.2, 1 a.a. ~ 187 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9140

Enviar un mensaje


ATG12 purified MaxPab mouse polyclonal antibody (B01P)

ATG12 purified MaxPab mouse polyclonal antibody (B01P)