CBFA2T2 purified MaxPab mouse polyclonal antibody (B01P)
  • CBFA2T2 purified MaxPab mouse polyclonal antibody (B01P)

CBFA2T2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009139-B01P
CBFA2T2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CBFA2T2 protein.
Información adicional
Size 50 ug
Gene Name CBFA2T2
Gene Alias DKFZp313F2116|EHT|MTGR1|ZMYND3
Gene Description core-binding factor, runt domain, alpha subunit 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MPGSPVEVKIQSRSSPPTMPPLPPINPGGPRPVSFTPTALSNGINHSPPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEKVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARAAKQTPSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRDTIAPEPPAKRVCTISPAPRHSPALTVPLMNPGGQF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CBFA2T2 (NP_001034798.1, 1 a.a. ~ 575 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9139

Enviar un mensaje


CBFA2T2 purified MaxPab mouse polyclonal antibody (B01P)

CBFA2T2 purified MaxPab mouse polyclonal antibody (B01P)