ARHGEF1 monoclonal antibody (M01), clone 1H4
  • ARHGEF1 monoclonal antibody (M01), clone 1H4

ARHGEF1 monoclonal antibody (M01), clone 1H4

Ref: AB-H00009138-M01
ARHGEF1 monoclonal antibody (M01), clone 1H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ARHGEF1.
Información adicional
Size 100 ug
Gene Name ARHGEF1
Gene Alias GEF1|LBCL2|LSC|P115-RHOGEF|SUB1.5
Gene Description Rho guanine nucleotide exchange factor (GEF) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPGCT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARHGEF1 (AAH34013.2, 830 a.a. ~ 927 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9138
Clone Number 1H4
Iso type IgG2a Kappa

Enviar un mensaje


ARHGEF1 monoclonal antibody (M01), clone 1H4

ARHGEF1 monoclonal antibody (M01), clone 1H4