ARHGEF1 polyclonal antibody (A01)
  • ARHGEF1 polyclonal antibody (A01)

ARHGEF1 polyclonal antibody (A01)

Ref: AB-H00009138-A01
ARHGEF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ARHGEF1.
Información adicional
Size 50 uL
Gene Name ARHGEF1
Gene Alias GEF1|LBCL2|LSC|P115-RHOGEF|SUB1.5
Gene Description Rho guanine nucleotide exchange factor (GEF) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq CRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPGCT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARHGEF1 (AAH34013, 830 a.a. ~ 927 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9138

Enviar un mensaje


ARHGEF1 polyclonal antibody (A01)

ARHGEF1 polyclonal antibody (A01)