RABEP1 monoclonal antibody (M06), clone 3H6
  • RABEP1 monoclonal antibody (M06), clone 3H6

RABEP1 monoclonal antibody (M06), clone 3H6

Ref: AB-H00009135-M06
RABEP1 monoclonal antibody (M06), clone 3H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RABEP1.
Información adicional
Size 100 ug
Gene Name RABEP1
Gene Alias RAB5EP|RABPT5
Gene Description rabaptin, RAB GTPase binding effector protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTDINQLPET
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RABEP1 (NP_004694.2, 765 a.a. ~ 862 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9135
Clone Number 3H6
Iso type IgG1 Kappa

Enviar un mensaje


RABEP1 monoclonal antibody (M06), clone 3H6

RABEP1 monoclonal antibody (M06), clone 3H6