KCNQ4 monoclonal antibody (M01), clone 2H6
  • KCNQ4 monoclonal antibody (M01), clone 2H6

KCNQ4 monoclonal antibody (M01), clone 2H6

Ref: AB-H00009132-M01
KCNQ4 monoclonal antibody (M01), clone 2H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KCNQ4.
Información adicional
Size 100 ug
Gene Name KCNQ4
Gene Alias DFNA2|KV7.4
Gene Description potassium voltage-gated channel, KQT-like subfamily, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AREKGDKGPSDAEVVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGAVQVPLFDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KCNQ4 (NP_004691, 596 a.a. ~ 695 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9132
Clone Number 2H6
Iso type IgG3 Kappa

Enviar un mensaje


KCNQ4 monoclonal antibody (M01), clone 2H6

KCNQ4 monoclonal antibody (M01), clone 2H6