SEC22L3 polyclonal antibody (A01)
  • SEC22L3 polyclonal antibody (A01)

SEC22L3 polyclonal antibody (A01)

Ref: AB-H00009117-A01
SEC22L3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SEC22L3.
Información adicional
Size 50 uL
Gene Name SEC22C
Gene Alias DKFZp761F2321|MGC13261|MGC5373|SEC22L3
Gene Description SEC22 vesicle trafficking protein homolog C (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEC22L3 (NP_116752, 3 a.a. ~ 68 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9117

Enviar un mensaje


SEC22L3 polyclonal antibody (A01)

SEC22L3 polyclonal antibody (A01)