LATS1 purified MaxPab mouse polyclonal antibody (B01P)
  • LATS1 purified MaxPab mouse polyclonal antibody (B01P)

LATS1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009113-B01P
LATS1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LATS1 protein.
Información adicional
Size 50 ug
Gene Name LATS1
Gene Alias WARTS|wts
Gene Description LATS, large tumor suppressor, homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEDMVIQALQKTNNRSIEAAIEFISKMSYQDPRREQMAAAAARPINASMKPGNVQQSVNRKQSWKGSKESLVPQRHGPPLGESVAYHSESPNSQTDVGRPLSGSGISAFVQAHPSNGQRVNPPPPPQVRSVTPPPPPRGQT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LATS1 (NP_004681.1, 1 a.a. ~ 1130 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9113

Enviar un mensaje


LATS1 purified MaxPab mouse polyclonal antibody (B01P)

LATS1 purified MaxPab mouse polyclonal antibody (B01P)