Ver mas grande
MTA1 monoclonal antibody (M10), clone 1C3
AB-H00009112-M10
Producto nuevo
MTA1 monoclonal antibody (M10), clone 1C3
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | MTA1 |
| Gene Alias | - |
| Gene Description | metastasis associated 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | MPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MTA1 (NP_004680, 601 a.a. ~ 700 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9112 |
| Clone Number | 1C3 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant MTA1.