MTA1 purified MaxPab rabbit polyclonal antibody (D01P)
  • MTA1 purified MaxPab rabbit polyclonal antibody (D01P)

MTA1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009112-D01P
MTA1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MTA1 protein.
Información adicional
Size 100 ug
Gene Name MTA1
Gene Alias -
Gene Description metastasis associated 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MKTRQAFYLHTTKLTRIARRLCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGTYLGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRPPPPAPVNDEPIVIED
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MTA1 (AAH06177.1, 1 a.a. ~ 255 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9112

Enviar un mensaje


MTA1 purified MaxPab rabbit polyclonal antibody (D01P)

MTA1 purified MaxPab rabbit polyclonal antibody (D01P)