NMI monoclonal antibody (M02), clone 10E5
  • NMI monoclonal antibody (M02), clone 10E5

NMI monoclonal antibody (M02), clone 10E5

Ref: AB-H00009111-M02
NMI monoclonal antibody (M02), clone 10E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NMI.
Información adicional
Size 100 ug
Gene Name NMI
Gene Alias -
Gene Description N-myc (and STAT) interactor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NMI (AAH01268, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9111
Clone Number 10E5
Iso type IgG2b Kappa

Enviar un mensaje


NMI monoclonal antibody (M02), clone 10E5

NMI monoclonal antibody (M02), clone 10E5