MTMR6 purified MaxPab rabbit polyclonal antibody (D01P)
  • MTMR6 purified MaxPab rabbit polyclonal antibody (D01P)

MTMR6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009107-D01P
MTMR6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MTMR6 protein.
Información adicional
Size 100 ug
Gene Name MTMR6
Gene Alias -
Gene Description myotubularin related protein 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEHIRTTKVEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSHQKETWILHHHIASVEKLALTTSGCPLVIQCKNFRTVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDSERLQGWQLIDLAEEYKRMGVPNSHWQLSDANRDYKICETYPRELYVPRIASKPIIVGSSKFRSKGRFPVLSYYHQDKEAAICRCSQPLSGFSARCLEDEHLLQAISKANPVNRYMYVMDTRPKLNAMANRAAGKGY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MTMR6 (AAH40012.1, 1 a.a. ~ 621 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9107

Enviar un mensaje


MTMR6 purified MaxPab rabbit polyclonal antibody (D01P)

MTMR6 purified MaxPab rabbit polyclonal antibody (D01P)