USP2 purified MaxPab rabbit polyclonal antibody (D01P)
  • USP2 purified MaxPab rabbit polyclonal antibody (D01P)

USP2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009099-D01P
USP2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human USP2 protein.
Información adicional
Size 100 ug
Gene Name USP2
Gene Alias UBP41|USP9
Gene Description ubiquitin specific peptidase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSQLSSTLKRYTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFLTRPRTYGPSSLLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNNCLSYLPINAYDQGVTLTQKLDSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIISPTYRPIGRYTLWETGKGQAPGPSRSSSPGR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen USP2 (AAH02955.1, 1 a.a. ~ 605 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9099

Enviar un mensaje


USP2 purified MaxPab rabbit polyclonal antibody (D01P)

USP2 purified MaxPab rabbit polyclonal antibody (D01P)