USP14 monoclonal antibody (M08), clone 1F8
  • USP14 monoclonal antibody (M08), clone 1F8

USP14 monoclonal antibody (M08), clone 1F8

Ref: AB-H00009097-M08
USP14 monoclonal antibody (M08), clone 1F8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP14.
Información adicional
Size 100 ug
Gene Name USP14
Gene Alias TGT
Gene Description ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP14 (NP_005142, 395 a.a. ~ 494 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9097
Clone Number 1F8
Iso type IgG2a Kappa

Enviar un mensaje


USP14 monoclonal antibody (M08), clone 1F8

USP14 monoclonal antibody (M08), clone 1F8