UNC119 purified MaxPab mouse polyclonal antibody (B01P)
  • UNC119 purified MaxPab mouse polyclonal antibody (B01P)

UNC119 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009094-B01P
UNC119 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UNC119 protein.
Información adicional
Size 50 ug
Gene Name UNC119
Gene Alias HRG4
Gene Description unc-119 homolog (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP,IF
Immunogen Prot. Seq MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UNC119 (NP_005139.1, 1 a.a. ~ 240 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9094

Enviar un mensaje


UNC119 purified MaxPab mouse polyclonal antibody (B01P)

UNC119 purified MaxPab mouse polyclonal antibody (B01P)