PIGQ monoclonal antibody (M02), clone 2B7
  • PIGQ monoclonal antibody (M02), clone 2B7

PIGQ monoclonal antibody (M02), clone 2B7

Ref: AB-H00009091-M02
PIGQ monoclonal antibody (M02), clone 2B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIGQ.
Información adicional
Size 100 ug
Gene Name PIGQ
Gene Alias GPI1|MGC12693|c407A10.1|hGPI1
Gene Description phosphatidylinositol glycan anchor biosynthesis, class Q
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq HCPMPTLCTQVQRVRPPQQPQVEGWSPWGLPSGSALAVGVEGPCQDEPPSPRHPLAPSAEQHPASGGLKQSLTPVPSGPGPSLPEPHGVYLRMFPGEV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIGQ (NP_683721.1, 661 a.a. ~ 758 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9091
Clone Number 2B7
Iso type IgG2a Kappa

Enviar un mensaje


PIGQ monoclonal antibody (M02), clone 2B7

PIGQ monoclonal antibody (M02), clone 2B7