PKMYT1 MaxPab rabbit polyclonal antibody (D01)
  • PKMYT1 MaxPab rabbit polyclonal antibody (D01)

PKMYT1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00009088-D01
PKMYT1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PKMYT1 protein.
Información adicional
Size 100 uL
Gene Name PKMYT1
Gene Alias DKFZp547K1610|FLJ20093|MYT1
Gene Description protein kinase, membrane associated tyrosine/threonine 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGSIPISRLFPPRTPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PKMYT1 (NP_004194.3, 1 a.a. ~ 499 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9088

Enviar un mensaje


PKMYT1 MaxPab rabbit polyclonal antibody (D01)

PKMYT1 MaxPab rabbit polyclonal antibody (D01)